PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000249.1_g00020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NF-YB
Protein Properties Length: 171aa    MW: 19520.4 Da    PI: 4.8293
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000249.1_g00020.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB168.57.8e-5317112297
                    NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvyl 87 
                              reqdr lPianv+rimkk+lPanak+skdaket+qecvsefi+fvt+eas+kc++e+rkt+ngdd++wa+a lGf+dy+ pl+ yl
  Itr_sc000249.1_g00020.1  17 REQDRWLPIANVGRIMKKTLPANAKVSKDAKETMQECVSEFIGFVTGEASEKCRKERRKTVNGDDICWAMAALGFDDYAPPLRRYL 102
                              89************************************************************************************ PP

                    NF-YB  88 kkyrelegek 97 
                              ++yr+ ege+
  Itr_sc000249.1_g00020.1 103 QRYRDQEGER 112
                              *******997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.0E-5312149IPR009072Histone-fold
SuperFamilySSF471131.24E-3819130IPR009072Histone-fold
PfamPF008082.2E-272286IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.5E-165068No hitNo description
PRINTSPR006152.5E-166987No hitNo description
PRINTSPR006152.5E-1688106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 171 aa     Download sequence    Send to blast
MAENSGPGGL NDDESFREQD RWLPIANVGR IMKKTLPANA KVSKDAKETM QECVSEFIGF  60
VTGEASEKCR KERRKTVNGD DICWAMAALG FDDYAPPLRR YLQRYRDQEG ERANQERVSN  120
EETENNINNQ FQEPSSSSYH RSHEDEAQQQ DFPSSSSSSF PMSFKSMSKP Y
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B2e-4416107192Transcription factor HapC (Eurofung)
4g92_B2e-4416107192Transcription factor HapC (Eurofung)
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006380166.12e-66hypothetical protein POPTR_0008s22520g
SwissprotO822483e-56NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBLB9N5182e-66B9N518_POPTR; Uncharacterized protein
STRINGPOPTR_0008s22520.16e-66(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11124356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.14e-57nuclear factor Y, subunit B5